LOCUS AF086793 426 bp DNA linear INV 25-JUL-2016 DEFINITION Plasmodium falciparum strain MAL-e15 liver stage-specific antigen-1 (LSA-1) gene, partial cds. ACCESSION AF086793 VERSION AF086793.1 KEYWORDS . SOURCE Plasmodium falciparum (malaria parasite P. falciparum) ORGANISM Plasmodium falciparum Eukaryota; Sar; Alveolata; Apicomplexa; Aconoidasida; Haemosporida; Plasmodiidae; Plasmodium; Plasmodium (Laverania). REFERENCE 1 (bases 1 to 426) AUTHORS Ravichandran,M., Doolan,D.L., Cox-Singh,J., Hoffman,S.L. and Singh,B. TITLE Research note: HLA degenerate T-cell epitopes from Plasmodium falciparum liver stage-specific antigen 1 (LSA-1) are highly conserved in isolates from geographically distinct areas JOURNAL Parasite Immunol. 22 (9), 469-473 (2000) PUBMED 10972854 REFERENCE 2 (bases 1 to 426) AUTHORS Ravichandran,M., Doolan,D.L., Cox-Singh,J., Hoffman,S.L. and Singh,B. TITLE Direct Submission JOURNAL Submitted (24-AUG-1998) Department of Microbiology and Parasitology, Universiti Sains Malaysia, Kubang Kerian, Kota Bharu, Kelantan 16150, Malaysia FEATURES Location/Qualifiers source 1..426 /organism="Plasmodium falciparum" /mol_type="genomic DNA" /strain="MAL-e15" /db_xref="taxon:5833" gene <30..>426 /gene="LSA-1" mRNA <30..>426 /gene="LSA-1" /product="liver stage-specific antigen-1" CDS 30..>426 /gene="LSA-1" /codon_start=1 /product="liver stage-specific antigen-1" /protein_id="AAC42977.1" /translation="MKHILYISFYFILVNLLIFHINGKIIKNSEKDEIIKSNLRSGSS NSRNRINEEKHEKKHVLSHNSYEKTKNNENNKFFDKDKELTMSNVKNVSQTNFKSLLR NLGVSENIFLKENKLNKEGKLIEHIINDDD" BASE COUNT 185 a 46 c 59 g 136 t ORIGIN 1 gtatacatct tccttcttta cttcttaaaa tgaaacatat tttgtacata tcattttact 61 ttatccttgt taatttattg atatttcata taaatggaaa gataataaag aattctgaaa 121 aagatgaaat cataaaatct aacttgagaa gtggttcttc aaattctagg aatcgaataa 181 atgaggaaaa gcacgagaag aaacacgttt tatctcataa ttcatatgag aaaactaaaa 241 ataatgaaaa taataaattt ttcgataagg ataaagagtt aacgatgtct aatgtaaaaa 301 atgtgtcaca aacaaatttc aaaagtcttt taagaaatct tggtgtttca gagaatatat 361 tccttaaaga aaataaatta aataaggaag ggaaattaat tgaacacata ataaatgacg 421 atgacg //