LOCUS       AF086793                 426 bp    DNA     linear   INV 25-JUL-2016
DEFINITION  Plasmodium falciparum strain MAL-e15 liver stage-specific antigen-1
            (LSA-1) gene, partial cds.
ACCESSION   AF086793
VERSION     AF086793.1
KEYWORDS    .
SOURCE      Plasmodium falciparum (malaria parasite P. falciparum)
  ORGANISM  Plasmodium falciparum
            Eukaryota; Sar; Alveolata; Apicomplexa; Aconoidasida; Haemosporida;
            Plasmodiidae; Plasmodium; Plasmodium (Laverania).
REFERENCE   1  (bases 1 to 426)
  AUTHORS   Ravichandran,M., Doolan,D.L., Cox-Singh,J., Hoffman,S.L. and
            Singh,B.
  TITLE     Research note: HLA degenerate T-cell epitopes from Plasmodium
            falciparum liver stage-specific antigen 1 (LSA-1) are highly
            conserved in isolates from geographically distinct areas
  JOURNAL   Parasite Immunol. 22 (9), 469-473 (2000)
   PUBMED   10972854
REFERENCE   2  (bases 1 to 426)
  AUTHORS   Ravichandran,M., Doolan,D.L., Cox-Singh,J., Hoffman,S.L. and
            Singh,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-AUG-1998) Department of Microbiology and
            Parasitology, Universiti Sains Malaysia, Kubang Kerian, Kota Bharu,
            Kelantan 16150, Malaysia
FEATURES             Location/Qualifiers
     source          1..426
                     /organism="Plasmodium falciparum"
                     /mol_type="genomic DNA"
                     /strain="MAL-e15"
                     /db_xref="taxon:5833"
     gene            <30..>426
                     /gene="LSA-1"
     mRNA            <30..>426
                     /gene="LSA-1"
                     /product="liver stage-specific antigen-1"
     CDS             30..>426
                     /gene="LSA-1"
                     /codon_start=1
                     /product="liver stage-specific antigen-1"
                     /protein_id="AAC42977.1"
                     /translation="MKHILYISFYFILVNLLIFHINGKIIKNSEKDEIIKSNLRSGSS
                     NSRNRINEEKHEKKHVLSHNSYEKTKNNENNKFFDKDKELTMSNVKNVSQTNFKSLLR
                     NLGVSENIFLKENKLNKEGKLIEHIINDDD"
BASE COUNT          185 a           46 c           59 g          136 t
ORIGIN      
        1 gtatacatct tccttcttta cttcttaaaa tgaaacatat tttgtacata tcattttact
       61 ttatccttgt taatttattg atatttcata taaatggaaa gataataaag aattctgaaa
      121 aagatgaaat cataaaatct aacttgagaa gtggttcttc aaattctagg aatcgaataa
      181 atgaggaaaa gcacgagaag aaacacgttt tatctcataa ttcatatgag aaaactaaaa
      241 ataatgaaaa taataaattt ttcgataagg ataaagagtt aacgatgtct aatgtaaaaa
      301 atgtgtcaca aacaaatttc aaaagtcttt taagaaatct tggtgtttca gagaatatat
      361 tccttaaaga aaataaatta aataaggaag ggaaattaat tgaacacata ataaatgacg
      421 atgacg
//