LOCUS AB567666 237 bp RNA linear ENV 16-JUN-2010 DEFINITION Hepatitis A virus gene for polyprotein, partial cds, collected from Philippines: Luzon, Metro Manila, sampling location number La2, collection date: 2009-03. ACCESSION AB567666 VERSION AB567666.1 KEYWORDS ENV. SOURCE Hepatitis A virus ORGANISM Hepatovirus A Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Picornavirales; Picornaviridae; Heptrevirinae; Hepatovirus. REFERENCE 1 (bases 1 to 237) AUTHORS Imagawa,T. and Suzuki,A. TITLE Direct Submission JOURNAL Submitted (09-JUN-2010) to the DDBJ/EMBL/GenBank databases. Contact:Toshifumi Imagawa TOHOKU University, Graduate school of Medicine, Deparment of Virology; Aoba, Seiryo-cho, 2-1, Sendai, Miyagi 980-8575, Japan REFERENCE 2 AUTHORS Imagawa,T., Suzuki,A., Saito,M., Masago,Y., Okumura,C., Lupisan,S., Olveda,R., Omura,T. and Oshitani,H. TITLE Detection of waterborne disease associated viruses from urban river in Metro Manila and Bulacan, the Philippines JOURNAL Published Only in Database(2010) COMMENT FEATURES Location/Qualifiers source 1..237 /collection_date="2009-03" /country="Philippines: Luzon, Metro Manila" /db_xref="taxon:12092" /environmental_sample /isolation_source="river water" /lat_lon="14.47 N 120.98 E" /mol_type="genomic RNA" /note="genotype: IA" /note="sampling location number: La2" /organism="Hepatitis A virus" CDS <1..>237 /codon_start=1 /note="VP1" /product="polyprotein" /protein_id="BAJ09594.1" /transl_table=1 /translation="YLSFSCYLSVTEQSEFYFPRAPLNSNAMLSTESMMSRIAAGDLE SSVDDPRSEEDRRFESHIECRKPYKELRLEVGKQR" mat_peptide <1..>237 /product="VP1 protein" BASE COUNT 75 a 35 c 57 g 70 t ORIGIN 1 tatttgtcct ttagttgtta cttgtctgtc acagaacaat cagagttcta ttttcctaga 61 gctccattaa attcaaatgc tatgctgtcc actgagtcca tgatgagtag aattgcagct 121 ggagatttgg agtcatcggt ggatgaccct agatcagagg aggatagaag atttgagagt 181 catatagaat gtaggaaacc atataaagaa ttgagattgg aggttggcaa acaaaga //