LOCUS       AB567666                 237 bp    RNA     linear   ENV 16-JUN-2010
DEFINITION  Hepatitis A virus gene for polyprotein, partial cds, collected
            from Philippines: Luzon, Metro Manila, sampling location number
            La2, collection date: 2009-03.
ACCESSION   AB567666
VERSION     AB567666.1
KEYWORDS    ENV.
SOURCE      Hepatitis A virus
  ORGANISM  Hepatovirus A
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Picornaviridae; Heptrevirinae; Hepatovirus.
REFERENCE   1  (bases 1 to 237)
  AUTHORS   Imagawa,T. and Suzuki,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUN-2010) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshifumi Imagawa
            TOHOKU University, Graduate school of Medicine, Deparment of
            Virology; Aoba, Seiryo-cho, 2-1, Sendai, Miyagi 980-8575, Japan
REFERENCE   2
  AUTHORS   Imagawa,T., Suzuki,A., Saito,M., Masago,Y., Okumura,C.,
            Lupisan,S., Olveda,R., Omura,T. and Oshitani,H.
  TITLE     Detection of waterborne disease associated viruses from urban
            river in Metro Manila and Bulacan, the Philippines
  JOURNAL   Published Only in Database(2010)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..237
                     /collection_date="2009-03"
                     /country="Philippines: Luzon, Metro Manila"
                     /db_xref="taxon:12092"
                     /environmental_sample
                     /isolation_source="river water"
                     /lat_lon="14.47 N 120.98 E"
                     /mol_type="genomic RNA"
                     /note="genotype: IA"
                     /note="sampling location number: La2"
                     /organism="Hepatitis A virus"
     CDS             <1..>237
                     /codon_start=1
                     /note="VP1"
                     /product="polyprotein"
                     /protein_id="BAJ09594.1"
                     /transl_table=1
                     /translation="YLSFSCYLSVTEQSEFYFPRAPLNSNAMLSTESMMSRIAAGDLE
                     SSVDDPRSEEDRRFESHIECRKPYKELRLEVGKQR"
     mat_peptide     <1..>237
                     /product="VP1 protein"
BASE COUNT           75 a           35 c           57 g           70 t
ORIGIN      
        1 tatttgtcct ttagttgtta cttgtctgtc acagaacaat cagagttcta ttttcctaga
       61 gctccattaa attcaaatgc tatgctgtcc actgagtcca tgatgagtag aattgcagct
      121 ggagatttgg agtcatcggt ggatgaccct agatcagagg aggatagaag atttgagagt
      181 catatagaat gtaggaaacc atataaagaa ttgagattgg aggttggcaa acaaaga
//