LOCUS CDQ48427.1 42 aa PRT BCT 04-FEB-2016 DEFINITION Vibrio anguillarum Ribosomal small subunit pseudouridine synthase protein. ACCESSION LK021129-530 PROTEIN_ID CDQ48427.1 SOURCE Vibrio anguillarum ORGANISM Vibrio anguillarum Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales; Vibrionaceae; Vibrio. REFERENCE 1 (bases 1 to 1187342) AUTHORS Holm K. JOURNAL Submitted (26-MAR-2014) to the INSDC. Norstruct, Dept of Chemistry, University of Tromso, Science Park 3, NO-9037 Tromso, NORWAY. REFERENCE 2 AUTHORS Holm K.O., Nilsson K., Hjerde E., Willassen N.P., Milton D.L. TITLE Complete genome sequence of Vibrio anguillarum strain NB10, a virulent isolate from the Gulf of Bothnia JOURNAL Stand Genomic Sci 10, 60-60(2015). PUBMED 26380645 FEATURES Qualifiers source /organism="Vibrio anguillarum" /chromosome="2" /host="Rainbow trout" /strain="NB10" /mol_type="genomic DNA" /country="Sweden:Baltic Sea, Norrbyn Umeaa" /isolation_source="clinical isolate, Rainbow trout" /serovar="O1" /db_xref="taxon:55601" protein /transl_table=11 /locus_tag="VANGNB10_cII0530c" /old_locus_tag="TVA3541a" /note="user locus_tag: VANGcII0530c" /note="ProtSeq: MRGLWRAYRLTITEGKFHQIKRMFSAVGNRVVSLHREAIGSV NLDVEVGKWRYLTDCEVQSFAK; protein_id (Crosa): AEH35230.1" BEGIN 1 MFSAVGNRVV SLHREAIGSV NLDVEVGKWR YLTDCEVQSF AK //