LOCUS Z46620 342 bp mRNA linear HUM 23-MAY-1995 DEFINITION H.sapiens mRNA for immunoglobulin kappa chain (g21). ACCESSION Z46620 VERSION Z46620.1 KEYWORDS immunoglobulin kappa chain; joining region; variable region. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 342) AUTHORS Giachino C., Padovan E., Lanzavecchia A. TITLE k+l+ dual receptor B cells are present in the human peripheral repertoire JOURNAL Unpublished. REFERENCE 2 (bases 1 to 342) AUTHORS Giachino C. JOURNAL Submitted (07-NOV-1994) to the INSDC. Giachino C., Basel Institute for Immunology, Grenzacherstrasse 487, Basel, Switzerland, 4005 REFERENCE 3 (bases 1 to 342) AUTHORS Giachino C., Padovan E., Lanzavecchia A. TITLE kappa+lambda+ dual receptor B cells are present in the human peripheral repertoire JOURNAL J. Exp. Med. 181(3), 1245-1250(1995). PUBMED 7869042 FEATURES Location/Qualifiers source 1..342 /organism="Homo sapiens" /mol_type="mRNA" /clone="G21" /cell_type="B-lymphocyte" /tissue_type="blood" /db_xref="taxon:9606" CDS <1..>342 /codon_start=1 /product="immunoglobulin kappa chain precursor" /citation=[1] /protein_id="CAA86590.1" /translation="DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQK PGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTLMC SFGQGTKLEIKR" V_region 1..298 /product="V kappa A3" /citation=[1] J_segment 302..342 /product="J kappa 2" /citation=[1] BASE COUNT 78 a 88 c 91 g 85 t ORIGIN 1 gatattgtga tgactcagtc tccactctcc ctgcccgtca cccctggaga gccggcctcc 61 atctcctgca ggtctagtca gagcctcctg catagtaatg gatacaacta tttggattgg 121 tacctgcaga agccagggca gtctccacag ctcctgatct atttgggttc taatcgggcc 181 tccggggtcc ctgacaggtt cagtggcagt ggatcaggca cagattttac actgaaaatc 241 agcagagtgg aggctgagga tgttggggtt tattactgca tgcaagctct acaaactctc 301 atgtgcagtt ttggccaggg gaccaagctg gagatcaaac ga //