LOCUS       Z46620                   342 bp    mRNA    linear   HUM 23-MAY-1995
DEFINITION  H.sapiens mRNA for immunoglobulin kappa chain (g21).
ACCESSION   Z46620
VERSION     Z46620.1
KEYWORDS    immunoglobulin kappa chain; joining region; variable region.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 342)
  AUTHORS   Giachino C., Padovan E., Lanzavecchia A.
  TITLE     k+l+ dual receptor B cells are present in the human peripheral
            repertoire
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 342)
  AUTHORS   Giachino C.
  JOURNAL   Submitted (07-NOV-1994) to the INSDC. Giachino C., Basel Institute
            for Immunology, Grenzacherstrasse 487, Basel, Switzerland, 4005
REFERENCE   3  (bases 1 to 342)
  AUTHORS   Giachino C., Padovan E., Lanzavecchia A.
  TITLE     kappa+lambda+ dual receptor B cells are present in the human
            peripheral repertoire
  JOURNAL   J. Exp. Med. 181(3), 1245-1250(1995).
   PUBMED   7869042
FEATURES             Location/Qualifiers
     source          1..342
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone="G21"
                     /cell_type="B-lymphocyte"
                     /tissue_type="blood"
                     /db_xref="taxon:9606"
     CDS             <1..>342
                     /codon_start=1
                     /product="immunoglobulin kappa chain precursor"
                     /citation=[1]
                     /protein_id="CAA86590.1"
                     /translation="DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQK
                     PGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTLMC
                     SFGQGTKLEIKR"
     V_region        1..298
                     /product="V kappa A3"
                     /citation=[1]
     J_segment       302..342
                     /product="J kappa 2"
                     /citation=[1]
BASE COUNT           78 a           88 c           91 g           85 t
ORIGIN      
        1 gatattgtga tgactcagtc tccactctcc ctgcccgtca cccctggaga gccggcctcc
       61 atctcctgca ggtctagtca gagcctcctg catagtaatg gatacaacta tttggattgg
      121 tacctgcaga agccagggca gtctccacag ctcctgatct atttgggttc taatcgggcc
      181 tccggggtcc ctgacaggtt cagtggcagt ggatcaggca cagattttac actgaaaatc
      241 agcagagtgg aggctgagga tgttggggtt tattactgca tgcaagctct acaaactctc
      301 atgtgcagtt ttggccaggg gaccaagctg gagatcaaac ga
//