LOCUS HUMIKCCR 300 bp mRNA linear HUM 10-MAY-1996 DEFINITION Homo sapiens (clone LBPBL5) immunoglobulin kappa light chain mRNA, partial cds. ACCESSION L40735 VERSION L40735.1 KEYWORDS immunoglobulin; kappa light chain. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 300) AUTHORS Bridges,S.L. Jr., Lee,S.K., Johnson,M.L., Lavelle,J.C., Fowler,P.G., Koopman,W.J. and Schroeder,H.W. Jr. TITLE Somatic mutation and CDR3 lengths of immunoglobulin kappa light chains expressed in patients with rheumatoid arthritis and in normal individuals JOURNAL J. Clin. Invest. 96 (2), 831-841 (1995) PUBMED 7635977 FEATURES Location/Qualifiers source 1..300 /db_xref="H-InvDB:HIT000193734" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="LBPBL5" /cell_type="B-lymphocyte" /tissue_type="blood" /dev_stage="adult" mRNA <1..>300 CDS <1..>300 /note="putative" /citation=[1] /codon_start=1 /product="immunoglobulin kappa chain" /protein_id="AAA99387.1" /translation="ATLSVSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDAS NRATGIPARFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPMCSFGQGTKLEIK" BASE COUNT 69 a 86 c 81 g 64 t ORIGIN 1 gccaccctgt ctgtgtctcc aggggaaaga gccaccctct cctgcagggc cagtcagagt 61 gttagcagct acttagcctg gtaccaacag aaacctggcc aggctcccag gctcctcatc 121 tatgatgcat ccaacagggc cactggcatc ccagccaggt tcagtggcag tgggtctggg 181 acagacttca ctctcaccat cagcagactg gagcctgaag attttgcagt gtattactgt 241 cagcagtatg gtagctcacc gatgtgcagt tttggccagg ggaccaagct ggagatcaaa //