LOCUS       HUMIKCCR                 300 bp    mRNA    linear   HUM 10-MAY-1996
DEFINITION  Homo sapiens (clone LBPBL5) immunoglobulin kappa light chain mRNA,
            partial cds.
ACCESSION   L40735
VERSION     L40735.1
KEYWORDS    immunoglobulin; kappa light chain.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 300)
  AUTHORS   Bridges,S.L. Jr., Lee,S.K., Johnson,M.L., Lavelle,J.C.,
            Fowler,P.G., Koopman,W.J. and Schroeder,H.W. Jr.
  TITLE     Somatic mutation and CDR3 lengths of immunoglobulin kappa light
            chains expressed in patients with rheumatoid arthritis and in
            normal individuals
  JOURNAL   J. Clin. Invest. 96 (2), 831-841 (1995)
   PUBMED   7635977
FEATURES             Location/Qualifiers
     source          1..300
                     /db_xref="H-InvDB:HIT000193734"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="LBPBL5"
                     /cell_type="B-lymphocyte"
                     /tissue_type="blood"
                     /dev_stage="adult"
     mRNA            <1..>300
     CDS             <1..>300
                     /note="putative"
                     /citation=[1]
                     /codon_start=1
                     /product="immunoglobulin kappa chain"
                     /protein_id="AAA99387.1"
                     /translation="ATLSVSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDAS
                     NRATGIPARFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPMCSFGQGTKLEIK"
BASE COUNT           69 a           86 c           81 g           64 t
ORIGIN      
        1 gccaccctgt ctgtgtctcc aggggaaaga gccaccctct cctgcagggc cagtcagagt
       61 gttagcagct acttagcctg gtaccaacag aaacctggcc aggctcccag gctcctcatc
      121 tatgatgcat ccaacagggc cactggcatc ccagccaggt tcagtggcag tgggtctggg
      181 acagacttca ctctcaccat cagcagactg gagcctgaag attttgcagt gtattactgt
      241 cagcagtatg gtagctcacc gatgtgcagt tttggccagg ggaccaagct ggagatcaaa
//