ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 35 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	AY237157	EGFP expression vector pBE, complete sequence.	5497	DNA	EGFP expression vector pBE
	BX430340	human full-length cDNA 5-PRIME end of clone CL0BB026ZB01 of NEUROBLASTOMA of Homo sapiens (human).	352	mRNA	Homo sapiens
	BX368383	human full-length cDNA 3-PRIME end of clone CS0DB001YB09 of NEUROBLASTOMA COT 10-NORMALIZED of Homo sapiens (human).	439	mRNA	Homo sapiens
	X00182	Gallus gallus cytoplasmic beta-actin gene.	5046	DNA	Gallus gallus
	CB018065	pgn1c.pk019.a16 Chicken lymphoid cDNA library (pgn1c) Gallus gallus cDNA clone pgn1c.pk019.a16 5' similar to emb\|X00182.1\|GGAC01 Gallus gallus cytoplasmic beta-actin gene, mRNA sequence.	398	mRNA	Gallus gallus
	BQ038784	pgn1c.pk010.g20 normalized chicken lymphoid cDNA library Gallus gallus cDNA clone pgn1c.pk010.g20 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	424	mRNA	Gallus gallus
	BI064632	pgf1n.pk002.a17 normalized chicken fat cDNA library Gallus gallus cDNA clone pgf1n.pk002.a17 5' similar to emb\|X00182.1\|GGAC01 Gallus gallus cytoplasmic beta-actin geneG, mRNA sequence.	315	mRNA	Gallus gallus
	BG625404	pgn1c.pk002.m1 Normalized chicken lymphoid cDNA library Gallus gallus cDNA clone pgn1c.pk002.m1 5' similar to emb\|X00182.1\|GGAC01 Gallus gallus cytoplasmic beta-actin geneG, mRNA sequence.	400	mRNA	Gallus gallus
	BQ037694	pgn1c.pk007.a11 normalized chicken lymphoid cDNA library Gallus gallus cDNA clone pgn1c.pk007.a11 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	620	mRNA	Gallus gallus
	CB017390	pgn1c.pk015.p7 Chicken lymphoid cDNA library (pgn1c) Gallus gallus cDNA clone pgn1c.pk015.p7 5' similar to emb\|X00182.1\|GGAC01 Gallus gallus cytoplasmic beta-actin gene, mRNA sequence.	487	mRNA	Gallus gallus
	BQ037297	pgn1c.pk005.m15 normalized chicken lymphoid cDNA library Gallus gallus cDNA clone pgn1c.pk005.m15 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	616	mRNA	Gallus gallus
	BQ037231	pgn1c.pk005.i8 normalized chicken lymphoid cDNA library Gallus gallus cDNA clone pgn1c.pk005.i8 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	600	mRNA	Gallus gallus
	BQ038431	pgn1c.pk009.f18 normalized chicken lymphoid cDNA library Gallus gallus cDNA clone pgn1c.pk009.f18 5' similar to emb\|X00182.1\|GGAC01 Gallus gallus cytoplasmic beta-actin gene, mRNA sequence.	477	mRNA	Gallus gallus
	BG625151	pgn1c.pk001.k6 Normalized chicken lymphoid cDNA library Gallus gallus cDNA clone pgn1c.pk001.k6 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus]G, mRNA sequence.	561	mRNA	Gallus gallus
	BI390204	pgp1c.pk003.i20 Primary Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1c.pk003.i20 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	649	mRNA	Gallus gallus
	BI393231	pgp1n.pk010.i9 Normalized Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1n.pk010.i9 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	661	mRNA	Gallus gallus
	BI394216	pgp1n.pk013.n3 Normalized Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1n.pk013.n3 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	647	mRNA	Gallus gallus
	BM425792	pgf2c.pk001.n2 Primary Chicken Abdominal Fat Library (pgf2c) Gallus gallus cDNA clone pgf2c.pk001.n2 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	632	mRNA	Gallus gallus
	BI391204	pgp1n.pk003.k2 Normalized Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1n.pk003.k2 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	586	mRNA	Gallus gallus
	BI391300	pgp1n.pk003.p18 Normalized Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1n.pk003.p18 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	645	mRNA	Gallus gallus
	BI389998	pgp1c.pk002.m4 Primary Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1c.pk002.m4 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	576	mRNA	Gallus gallus
	BI391275	pgp1n.pk003.o13 Normalized Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1n.pk003.o13 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	671	mRNA	Gallus gallus
	BI392085	pgp1n.pk006.l13 Normalized Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1n.pk006.l13 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	641	mRNA	Gallus gallus
	BI394527	pgp1n.pk014.p17 Normalized Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1n.pk014.p17 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	667	mRNA	Gallus gallus
	BM485244	pgm1n.pk001.a15 Normalized Chicken Breast Muscle, Leg Muscle, and Epiphyseal Growth Plate cDNA library (pgm1n) Gallus gallus cDNA clone pgm1n.pk001.a15 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	662	mRNA	Gallus gallus
	BI392215	pgp1n.pk007.c20 Normalized Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1n.pk007.c20 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	667	mRNA	Gallus gallus
	BM425559	pgf2c.pk001.d12 Primary Chicken Abdominal Fat Library (pgf2c) Gallus gallus cDNA clone pgf2c.pk001.d12 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	631	mRNA	Gallus gallus
	BI390518	pgp1n.pk001.d4 Normalized Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1n.pk001.d4 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	646	mRNA	Gallus gallus
	BI391217	pgp1n.pk003.l10 Normalized Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1n.pk003.l10 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	661	mRNA	Gallus gallus
	BI391349	pgp1n.pk004.b5 Normalized Chicken Pituitary/Hypothalamus/Pineal Library Gallus gallus cDNA clone pgp1n.pk004.b5 5' similar to emb\|CAA25004.1 (X00182) beta-actin [Gallus gallus], mRNA sequence.	655	mRNA	Gallus gallus
Now loading

PAGE TOP