ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 24 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	KC877511	Homo sapiens chromosome 12 clone WGS_LWK_U47924.1_17752 genomic sequence.	255	DNA	Homo sapiens
	KC877513	Homo sapiens chromosome 12 clone WGS_PUR_U47924.1_67062 genomic sequence.	481	DNA	Homo sapiens
	KC877508	Homo sapiens chromosome 12 clone WGS_CEU_U47924.1_59992 genomic sequence.	499	DNA	Homo sapiens
	KF511186	Homo sapiens chromosome 12 WGS contig WGS_FIN_U47924.1_132021 genomic sequence.	379	DNA	Homo sapiens
	KF511183	Homo sapiens chromosome 12 WGS contig WGS_PUR_U47924.1_37362 genomic sequence.	368	DNA	Homo sapiens
	KF459681	Homo sapiens chromosome 12 WGS contig WGS_GBR_U47924.1_40869 genomic sequence.	340	DNA	Homo sapiens
	F23093	Sus scrofa mRNA; expressed sequence tag (5'; clone c21e04).	402	mRNA	Sus scrofa
	DJ465959	JP 2005160302-A/18300: Method for analysing genome using microsatellite genetic polymorphism markers.	229	DNA	Homo sapiens
	AI726483	BNLGHi5965 Six-day Cotton fiber Gossypium hirsutum cDNA 5' similar to (U47924) DRPLA [Homo sapiens], mRNA sequence.	523	mRNA	Gossypium hirsutum
	AI726654	BNLGHi5771 Six-day Cotton fiber Gossypium hirsutum cDNA 5' similar to (U47924) DRPLA [Homo sapiens], mRNA sequence.	580	mRNA	Gossypium hirsutum
	AI726150	BNLGHi5089 Six-day Cotton fiber Gossypium hirsutum cDNA 5' similar to (U47924) DRPLA [Homo sapiens], mRNA sequence.	668	mRNA	Gossypium hirsutum
	AI727876	BNLGHi9345 Six-day Cotton fiber Gossypium hirsutum cDNA 5' similar to (U47924) DRPLA [Homo sapiens], mRNA sequence.	722	mRNA	Gossypium hirsutum
	AI730762	BNLGHi7851 Six-day Cotton fiber Gossypium hirsutum cDNA 5' similar to (U47924) DRPLA [Homo sapiens], mRNA sequence.	547	mRNA	Gossypium hirsutum
	AI729566	BNLGHi13638 Six-day Cotton fiber Gossypium hirsutum cDNA 5' similar to (U47924) DRPLA [Homo sapiens], mRNA sequence.	525	mRNA	Gossypium hirsutum
	AI729965	BNLGHi5819 Six-day Cotton fiber Gossypium hirsutum cDNA 5' similar to (U47924) DRPLA [Homo sapiens], mRNA sequence.	591	mRNA	Gossypium hirsutum
	AW355711	pft1c.pk004.f1 chicken fat cDNA library pSPORT1 Gallus gallus cDNA clone pft1c.pk004.f1 5' similar to (U47924) DRPLA [Homo sapiens], mRNA sequence.	434	mRNA	Gallus gallus
	LN847494	TPA: Homo sapiens SCARNA12 gene for small nucleolar RNA SCARNA12.	270	DNA	Homo sapiens
	BM491531	pgp2n.pk006.k6 Normalized Chicken Pituitary/Hypothalamus/Pineal Library (pgp2n) Gallus gallus cDNA clone pgp2n.pk006.k6 5' similar to ref\|NP_009204.1 (NM_007273) B-cell associated protein [Homo sapiens] gb\|AAB51324.1\| (U47924) B-cell receptor associated protein [Homo sapiens] gb\|AAC36005.1\| (AC002397) BAP [Mus musculus] gb\|AAD38042.1\|AF150962_1 (AF150962) repressor of estroge, mRNA sequence.	519	mRNA	Gallus gallus
	CD216519	pgm2n.pk013.o19 Normalized chicken muscle cDNA library (pgm2n) Gallus gallus cDNA clone pgm2n.pk013.o19 5' similar to ref\|NP_009204.1 (NM_007273) B-cell associated protein [Homo sapiens] gb\|AAB51324.1\| (U47924) B-cell receptor associated protein [Homo sapiens] gb\|AAC36005.1\| (AC002397) B, mRNA sequence.	605	mRNA	Gallus gallus
	GL000105	Homo sapiens chromosome 12 genomic contig, GRCh38 reference primary assembly.	7073650	DNA	Homo sapiens
	AA297125	EST112701 Cerebellum II Homo sapiens cDNA 5' end similar to hypothetical protein A (GB:U47924), mRNA sequence.	306	mRNA	Homo sapiens
	AA325927	EST29030 Cerebellum II Homo sapiens cDNA 5' end similar to hypothetical protein A (GB:U47924), mRNA sequence.	216	mRNA	Homo sapiens
	AF027390	Homo sapiens 7q telomere, complete sequence.	225432	DNA	Homo sapiens
	U47924	Human chromosome 12p13 sequence, complete sequence.	222930	DNA	Homo sapiens
Now loading

PAGE TOP