ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 43 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	U15029	Escherichia coli (orf1) and isoaspartyl dipeptidase (iadA) genes, complete cds, and (orf2) gene, partial cds.	2604	DNA	Escherichia coli str. K-12 substr. W3110
	X77707	E.coli ORF112, DIPZ and ORF191 genes.	2897	DNA	Escherichia coli
	AL121850	Streptomyces coelicolor cosmid C78 (contained entirely in cosmid St3H12 therefore duplicated).	3875	DNA	Streptomyces coelicolor
	AY094053	Arabidopsis thaliana AT5g02020/T7H20_70 mRNA, complete cds.	450	mRNA	Arabidopsis thaliana
	L42023	Haemophilus influenzae Rd KW20 chromosome, complete genome.	1830138	DNA	Haemophilus influenzae Rd KW20
	AL049913	Mycobacterium leprae cosmid B1610.	40055	DNA	Mycobacterium leprae
	AE003853	Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence.	1072315	DNA	Vibrio cholerae O1 biovar El Tor str. N16961
	AE000511	Helicobacter pylori 26695, complete genome.	1667867	DNA	Helicobacter pylori 26695
	AE003852	Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence.	2961149	DNA	Vibrio cholerae O1 biovar El Tor str. N16961
	U14003	Escherichia coli K-12 chromosomal region from 92.8 to 00.1 minutes.	338534	DNA	Escherichia coli str. K-12 substr. MG1655
	AL939106	Streptomyces coelicolor A3(2) complete genome; segment 3/29.	314100	DNA	Streptomyces coelicolor
	AE000520	Treponema pallidum subsp. pallidum str. Nichols complete genome.	1138011	DNA	Treponema pallidum subsp. pallidum str. Nichols
	AL117189	Yersinia pestis CO92 plasmid pCD1.	70305	DNA	Yersinia pestis CO92
	AE002160	Chlamydia muridarum Nigg, complete genome.	1072950	DNA	Chlamydia muridarum str. Nigg
	AL939112	Streptomyces coelicolor A3(2) complete genome; segment 9/29.	300800	DNA	Streptomyces coelicolor
	AE000513	Deinococcus radiodurans R1 chromosome 1, complete sequence.	2648638	DNA	Deinococcus radiodurans R1
	AE004092	Streptococcus pyogenes M1 GAS, complete genome.	1852433	DNA	Streptococcus pyogenes M1 GAS
	AE015925	Chlamydophila caviae GPIC, complete genome.	1173390	DNA	Chlamydia caviae GPIC
	AE002161	Chlamydophila pneumoniae AR39, complete genome.	1229853	DNA	Chlamydia pneumoniae AR39
	AF348706	Shigella flexneri 5a str. M90T plasmid pWR501, complete sequence.	221851	DNA	Shigella flexneri 5a str. M90T
	AL939107	Streptomyces coelicolor A3(2) complete genome; segment 4/29.	298450	DNA	Streptomyces coelicolor
	AL939104	Streptomyces coelicolor A3(2) complete genome; segment 1/29.	299050	DNA	Streptomyces coelicolor
	AE014133	Streptococcus mutans UA159, complete genome.	2032925	DNA	Streptococcus mutans UA159
	L77117	Methanocaldococcus jannaschii DSM 2661, complete genome.	1664970	DNA	Methanocaldococcus jannaschii DSM 2661
	AL939109	Streptomyces coelicolor A3(2) complete genome; segment 6/29.	277000	DNA	Streptomyces coelicolor
	AL939120	Streptomyces coelicolor A3(2) complete genome; segment 17/29.	248550	DNA	Streptomyces coelicolor
	AE015924	Porphyromonas gingivalis W83, complete genome.	2343476	DNA	Porphyromonas gingivalis W83
	AL939130	Streptomyces coelicolor A3(2) complete genome; segment 27/29.	303450	DNA	Streptomyces coelicolor
	AL939118	Streptomyces coelicolor A3(2) complete genome; segment 15/29.	303550	DNA	Streptomyces coelicolor
	AL939119	Streptomyces coelicolor A3(2) complete genome; segment 16/29.	299050	DNA	Streptomyces coelicolor
Now loading

PAGE TOP