ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 87 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	T00038	wEST00759 Early embryo, Stratagene (cat. #937007) Caenorhabditis elegans cDNA clone CEESA82 similar to Ribosomal phosphoprotein P1, mRNA sequence.	411	mRNA	Caenorhabditis elegans
	JP288133	TSA: Thalassiosira oceanica To_t00038 mRNA sequence.	379	mRNA	Thalassiosira oceanica
	DS571522	Entamoeba histolytica HM-1:IMSS scf_1104750517613 genomic scaffold, whole genome shotgun sequence.	12812	DNA	Entamoeba histolytica HM-1:IMSS
	DS571343	Entamoeba histolytica HM-1:IMSS scf_1104750518829 genomic scaffold, whole genome shotgun sequence.	31198	DNA	Entamoeba histolytica HM-1:IMSS
	DS571388	Entamoeba histolytica HM-1:IMSS scf_1104750517573 genomic scaffold, whole genome shotgun sequence.	23465	DNA	Entamoeba histolytica HM-1:IMSS
	DS571307	Entamoeba histolytica HM-1:IMSS scf_1104750517647 genomic scaffold, whole genome shotgun sequence.	36793	DNA	Entamoeba histolytica HM-1:IMSS
	DS571286	Entamoeba histolytica HM-1:IMSS scf_1104750516671 genomic scaffold, whole genome shotgun sequence.	42641	DNA	Entamoeba histolytica HM-1:IMSS
	DS571337	Entamoeba histolytica HM-1:IMSS scf_1104750517505 genomic scaffold, whole genome shotgun sequence.	31836	DNA	Entamoeba histolytica HM-1:IMSS
	DQ273271	Asparagus officinalis clone B4-L7-94, * SEQUENCING IN PROGRESS *, 11 unordered pieces.	112052	DNA	Asparagus officinalis
	DS571347	Entamoeba histolytica HM-1:IMSS scf_1104750517069 genomic scaffold, whole genome shotgun sequence.	30850	DNA	Entamoeba histolytica HM-1:IMSS
	DS571211	Entamoeba histolytica HM-1:IMSS scf_1104750517595 genomic scaffold, whole genome shotgun sequence.	68604	DNA	Entamoeba histolytica HM-1:IMSS
	DS571243	Entamoeba histolytica HM-1:IMSS scf_1104750518435 genomic scaffold, whole genome shotgun sequence.	52018	DNA	Entamoeba histolytica HM-1:IMSS
	DS571225	Entamoeba histolytica HM-1:IMSS scf_1104750517093 genomic scaffold, whole genome shotgun sequence.	58471	DNA	Entamoeba histolytica HM-1:IMSS
	DS571241	Entamoeba histolytica HM-1:IMSS scf_1104750518413 genomic scaffold, whole genome shotgun sequence.	53356	DNA	Entamoeba histolytica HM-1:IMSS
	DS571230	Entamoeba histolytica HM-1:IMSS scf_1104750519139 genomic scaffold, whole genome shotgun sequence.	57127	DNA	Entamoeba histolytica HM-1:IMSS
	AC183494	Brassica oleracea Contig C, complete sequence.	285752	DNA	Brassica oleracea
	DS571168	Entamoeba histolytica HM-1:IMSS scf_1104750516425 genomic scaffold, whole genome shotgun sequence.	118395	DNA	Entamoeba histolytica HM-1:IMSS
	DS571186	Entamoeba histolytica HM-1:IMSS scf_1104750516279 genomic scaffold, whole genome shotgun sequence.	90397	DNA	Entamoeba histolytica HM-1:IMSS
	AC183493	Brassica oleracea Contig B, complete sequence.	284024	DNA	Brassica oleracea
	DS571187	Entamoeba histolytica HM-1:IMSS scf_1104750518411 genomic scaffold, whole genome shotgun sequence.	89534	DNA	Entamoeba histolytica HM-1:IMSS
	DS571195	Entamoeba histolytica HM-1:IMSS scf_1104750516339 genomic scaffold, whole genome shotgun sequence.	77971	DNA	Entamoeba histolytica HM-1:IMSS
	DS571227	Entamoeba histolytica HM-1:IMSS scf_1104750516361 genomic scaffold, whole genome shotgun sequence.	58118	DNA	Entamoeba histolytica HM-1:IMSS
	DS571185	Entamoeba histolytica HM-1:IMSS scf_1104750517879 genomic scaffold, whole genome shotgun sequence.	90489	DNA	Entamoeba histolytica HM-1:IMSS
	DS571204	Entamoeba histolytica HM-1:IMSS scf_1104750517881 genomic scaffold, whole genome shotgun sequence.	72267	DNA	Entamoeba histolytica HM-1:IMSS
	AC183436	Asparagus officinalis clone 025-31L4, * SEQUENCING IN PROGRESS *, 26 unordered pieces.	101471	DNA	Asparagus officinalis
	DS571207	Entamoeba histolytica HM-1:IMSS scf_1104750518851 genomic scaffold, whole genome shotgun sequence.	71103	DNA	Entamoeba histolytica HM-1:IMSS
	DS571215	Entamoeba histolytica HM-1:IMSS scf_1104750516687 genomic scaffold, whole genome shotgun sequence.	64584	DNA	Entamoeba histolytica HM-1:IMSS
	DS571174	Entamoeba histolytica HM-1:IMSS scf_1104750516811 genomic scaffold, whole genome shotgun sequence.	102655	DNA	Entamoeba histolytica HM-1:IMSS
	DS571190	Entamoeba histolytica HM-1:IMSS scf_1104750516869 genomic scaffold, whole genome shotgun sequence.	82939	DNA	Entamoeba histolytica HM-1:IMSS
	AC183496	Brassica oleracea, * SEQUENCING IN PROGRESS *.	385314	DNA	Brassica oleracea
Now loading

PAGE TOP