ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 221 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	T00011	wEST00732 Early embryo, Stratagene (cat. #937007) Caenorhabditis elegans cDNA clone CEESA53 similar to Ribosomal protein L3, mRNA sequence.	300	mRNA	Caenorhabditis elegans
	DS571803	Entamoeba histolytica HM-1:IMSS scf_1104750517295 genomic scaffold, whole genome shotgun sequence.	3907	DNA	Entamoeba histolytica HM-1:IMSS
	JP288108	TSA: Thalassiosira oceanica To_t00011 mRNA sequence.	216	mRNA	Thalassiosira oceanica
	DS571623	Entamoeba histolytica HM-1:IMSS scf_1104750516407 genomic scaffold, whole genome shotgun sequence.	8217	DNA	Entamoeba histolytica HM-1:IMSS
	DS571655	Entamoeba histolytica HM-1:IMSS scf_1104750518729 genomic scaffold, whole genome shotgun sequence.	7001	DNA	Entamoeba histolytica HM-1:IMSS
	DS571519	Entamoeba histolytica HM-1:IMSS scf_1104750518333 genomic scaffold, whole genome shotgun sequence.	13034	DNA	Entamoeba histolytica HM-1:IMSS
	DS571602	Entamoeba histolytica HM-1:IMSS scf_1104750516757 genomic scaffold, whole genome shotgun sequence.	9073	DNA	Entamoeba histolytica HM-1:IMSS
	DS571493	Entamoeba histolytica HM-1:IMSS scf_1104750516581 genomic scaffold, whole genome shotgun sequence.	14707	DNA	Entamoeba histolytica HM-1:IMSS
	DS571436	Entamoeba histolytica HM-1:IMSS scf_1104750519089 genomic scaffold, whole genome shotgun sequence.	18555	DNA	Entamoeba histolytica HM-1:IMSS
	DS571424	Entamoeba histolytica HM-1:IMSS scf_1104750519167 genomic scaffold, whole genome shotgun sequence.	19742	DNA	Entamoeba histolytica HM-1:IMSS
	CX196618	Sa_mx0_47g09_SP6 Dogfish Shark Multiple Tissues, Normalized Squalus acanthias cDNA clone Sa_mx0_47g09 5' similar to gb\|EAL44239.1\| hypothetical protein 284.t00011 - Entamoeba histolytica HM-1:IMSS. Score = 34.7 bits (78), Expect = 2.2, mRNA sequence.	708	mRNA	Squalus acanthias
	CX196402	Sa_mx0_45b01_SP6 Dogfish Shark Multiple Tissues, Normalized Squalus acanthias cDNA clone Sa_mx0_45b01 5' similar to gb\|EAL45453.1\| hypothetical protein 196.t00011 - Entamoeba histolytica HM-1:IMSS. Score = 32.7 bits (73), Expect = 7.7, mRNA sequence.	673	mRNA	Squalus acanthias
	DS571358	Entamoeba histolytica HM-1:IMSS scf_1104750516819 genomic scaffold, whole genome shotgun sequence.	28351	DNA	Entamoeba histolytica HM-1:IMSS
	AC183434	Asparagus officinalis clone 025-106C13, * SEQUENCING IN PROGRESS *, 13 unordered pieces.	72481	DNA	Asparagus officinalis
	DS571386	Entamoeba histolytica HM-1:IMSS scf_1104750517783 genomic scaffold, whole genome shotgun sequence.	24145	DNA	Entamoeba histolytica HM-1:IMSS
	DS571425	Entamoeba histolytica HM-1:IMSS scf_1104750517931 genomic scaffold, whole genome shotgun sequence.	19574	DNA	Entamoeba histolytica HM-1:IMSS
	DS571473	Entamoeba histolytica HM-1:IMSS scf_1104750518825 genomic scaffold, whole genome shotgun sequence.	16111	DNA	Entamoeba histolytica HM-1:IMSS
	DS571312	Entamoeba histolytica HM-1:IMSS scf_1104750516765 genomic scaffold, whole genome shotgun sequence.	36157	DNA	Entamoeba histolytica HM-1:IMSS
	DS571380	Entamoeba histolytica HM-1:IMSS scf_1104750517521 genomic scaffold, whole genome shotgun sequence.	25024	DNA	Entamoeba histolytica HM-1:IMSS
	DS571578	Entamoeba histolytica HM-1:IMSS scf_1104750516895 genomic scaffold, whole genome shotgun sequence.	9890	DNA	Entamoeba histolytica HM-1:IMSS
	DS571421	Entamoeba histolytica HM-1:IMSS scf_1104750518251 genomic scaffold, whole genome shotgun sequence.	20065	DNA	Entamoeba histolytica HM-1:IMSS
	AC183411	Asparagus officinalis clone C5-O1-101, * SEQUENCING IN PROGRESS *, 2 ordered pieces.	52286	DNA	Asparagus officinalis
	DS571379	Entamoeba histolytica HM-1:IMSS scf_1104750518137 genomic scaffold, whole genome shotgun sequence.	25092	DNA	Entamoeba histolytica HM-1:IMSS
	DS571387	Entamoeba histolytica HM-1:IMSS scf_1104750516667 genomic scaffold, whole genome shotgun sequence.	23737	DNA	Entamoeba histolytica HM-1:IMSS
	DS571466	Entamoeba histolytica HM-1:IMSS scf_1104750517539 genomic scaffold, whole genome shotgun sequence.	16384	DNA	Entamoeba histolytica HM-1:IMSS
	DS571367	Entamoeba histolytica HM-1:IMSS scf_1104750517677 genomic scaffold, whole genome shotgun sequence.	26955	DNA	Entamoeba histolytica HM-1:IMSS
	DS571502	Entamoeba histolytica HM-1:IMSS scf_1104750518299 genomic scaffold, whole genome shotgun sequence.	14282	DNA	Entamoeba histolytica HM-1:IMSS
	DS571272	Entamoeba histolytica HM-1:IMSS scf_1104750518987 genomic scaffold, whole genome shotgun sequence.	46543	DNA	Entamoeba histolytica HM-1:IMSS
	DS571369	Entamoeba histolytica HM-1:IMSS scf_1104750517475 genomic scaffold, whole genome shotgun sequence.	26785	DNA	Entamoeba histolytica HM-1:IMSS
	DS571488	Entamoeba histolytica HM-1:IMSS scf_1104750518183 genomic scaffold, whole genome shotgun sequence.	14960	DNA	Entamoeba histolytica HM-1:IMSS
Now loading

PAGE TOP