ARSA | DDBJ | Search Result

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	S43429	23S ribosomal RNA [Bacillus cereus, NCTC 11143, Genomic, 2921 nt].	2921	DNA	Bacillus cereus
	H78765	yu29c01.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:235200 5' similar to SP:S43429 S43429 SPERMIDINE/SPERMINE N1-ACETYLTRANSFERASE, mRNA sequence.	368	mRNA	Homo sapiens
	T51899	yb54f12.r1 Stratagene ovary (#937217) Homo sapiens cDNA clone IMAGE:75023 5' similar to similar to SP:S43429 S43429 SPERMIDINE/SPERMINE N1-ACETYLTRANSFERASE, mRNA sequence.	88	mRNA	Homo sapiens
	H25966	yl56c08.r1 Soares breast 3NbHBst Homo sapiens cDNA clone IMAGE:162254 5' similar to SP:S43429 S43429 SPERMIDINE/SPERMINE N1-ACETYLTRANSFERASE, mRNA sequence.	370	mRNA	Homo sapiens
	HO401925	chaetospheridium_74953.1_s43429_c Chaetosphaeridium globosum EST library Chaetosphaeridium globosum cDNA 5', mRNA sequence.	422	mRNA	Chaetosphaeridium globosum
	HO452134	klebsormidium_60434_s43429_c Klebsormidium flaccidum EST library Klebsormidium flaccidum cDNA 5', mRNA sequence.	202	mRNA	Klebsormidium flaccidum
	H46490	yo20c07.r1 Soares adult brain N2b5HB55Y Homo sapiens cDNA clone IMAGE:178476 5' similar to SP:S43429 S43429 SPERMIDINE/SPERMINE N1-ACETYLTRANSFERASE, mRNA sequence.	130	mRNA	Homo sapiens
	T69059	yc31b04.r1 Stratagene liver (#937224) Homo sapiens cDNA clone IMAGE:82255 5' similar to SP:S43429 S43429 SPERMIDINE/SPERMINE N1-ACETYLTRANSFERASE, mRNA sequence.	139	mRNA	Homo sapiens
	BG713510	pgl1n.pk007.d10 Normalized Liver Library Gallus gallus cDNA clone pgl1n.pk007.d10 5' similar to gi\|6677849 ref\|NP_033147.1\| spermidine/spermine N1-acetyl transferase [Mus musculus] sp\|P48026\|ATDA_MOUSE DIAMINE ACETYLTRANSFERASE (SPERMIDINE/SPERMINE N1-ACETYLTRANSFERASE) (SSAT) (PUTRESCINE ACETYLTRANSFERASE) pir\|S43429 diamine N-acetyltransfera, mRNA sequence.	552	mRNA	Gallus gallus
Now loading

ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Search Result

Facet

List of Entries