ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 40 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	HM068962	Clonorchis sinensis clone L10328 genomic sequence.	540	DNA	Clonorchis sinensis
	B07884	YX87T3 pBluescript expression library of genomic DNA from OG1RF Enterococcus faecalis OG1RF genomic clone YX87 similar to hypothetical transcriptional regulator in ilvO- ibpB intergenic region of E. coli (L10328), genomic survey sequence.	738	DNA	Enterococcus faecalis OG1RF
	U87804	Caulobacter crescentus 50 kDa protein (ogt) gene, partial cds; and GidA (gidA), GidB (gidB), ParA (parA), and ParB (parB) genes, complete cds.	5787	DNA	Caulobacter vibrioides NA1000
	AC068735	Homo sapiens clone RP11-594J3, WORKING DRAFT SEQUENCE, 27 unordered pieces.	158989	DNA	Homo sapiens
	L42023	Haemophilus influenzae Rd KW20 chromosome, complete genome.	1830138	DNA	Haemophilus influenzae Rd KW20
	AE001825	Deinococcus radiodurans R1 chromosome 2, complete sequence.	412348	DNA	Deinococcus radiodurans R1
	L10328	E. coli; the region from 81.5 to 84.5 minutes.	136254	DNA	Escherichia coli
	AE003853	Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence.	1072315	DNA	Vibrio cholerae O1 biovar El Tor str. N16961
	U00039	E. coli chromosomal region from 76.0 to 81.5 minutes.	225419	DNA	Escherichia coli str. K-12 substr. MG1655
	AE003852	Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence.	2961149	DNA	Vibrio cholerae O1 biovar El Tor str. N16961
	AE015925	Chlamydophila caviae GPIC, complete genome.	1173390	DNA	Chlamydia caviae GPIC
	L77117	Methanocaldococcus jannaschii DSM 2661, complete genome.	1664970	DNA	Methanocaldococcus jannaschii DSM 2661
	AE002161	Chlamydophila pneumoniae AR39, complete genome.	1229853	DNA	Chlamydia pneumoniae AR39
	U00006	Escherichia coli str. K-12 substr. MG1655 chromosomal region from 89.2 to 92.8 minutes.	176195	DNA	Escherichia coli str. K-12 substr. MG1655
	AL939132	Streptomyces coelicolor A3(2) complete genome; segment 29/29.	302007	DNA	Streptomyces coelicolor
	AL939109	Streptomyces coelicolor A3(2) complete genome; segment 6/29.	277000	DNA	Streptomyces coelicolor
	AL939113	Streptomyces coelicolor A3(2) complete genome; segment 10/29.	310550	DNA	Streptomyces coelicolor
	AE000511	Helicobacter pylori 26695, complete genome.	1667867	DNA	Helicobacter pylori 26695
	AE000513	Deinococcus radiodurans R1 chromosome 1, complete sequence.	2648638	DNA	Deinococcus radiodurans R1
	AE000520	Treponema pallidum subsp. pallidum str. Nichols complete genome.	1138011	DNA	Treponema pallidum subsp. pallidum str. Nichols
	AL939105	Streptomyces coelicolor A3(2) complete genome; segment 2/29.	291000	DNA	Streptomyces coelicolor
	BX294148	Rhodopirellula baltica SH 1 complete genome; segment 16/24.	294850	DNA	Rhodopirellula baltica SH 1
	BX294154	Rhodopirellula baltica SH 1 complete genome; segment 22/24.	299050	DNA	Rhodopirellula baltica SH 1
	AL939112	Streptomyces coelicolor A3(2) complete genome; segment 9/29.	300800	DNA	Streptomyces coelicolor
	AE000782	Archaeoglobus fulgidus DSM 4304, complete genome.	2178400	DNA	Archaeoglobus fulgidus DSM 4304
	AL939127	Streptomyces coelicolor A3(2) complete genome; segment 24/29.	290850	DNA	Streptomyces coelicolor
	BX294137	Rhodopirellula baltica SH 1 complete genome; segment 5/24.	302550	DNA	Rhodopirellula baltica SH 1
	AL939118	Streptomyces coelicolor A3(2) complete genome; segment 15/29.	303550	DNA	Streptomyces coelicolor
	AL939106	Streptomyces coelicolor A3(2) complete genome; segment 3/29.	314100	DNA	Streptomyces coelicolor
	AL939108	Streptomyces coelicolor A3(2) complete genome; segment 5/29.	339650	DNA	Streptomyces coelicolor
Now loading

PAGE TOP