ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 221 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	AC002062	Sequence of BAC F20P5 from Arabidopsis thaliana chromosome 1, complete sequence.	114505	DNA	Arabidopsis thaliana
	B09592	F20P5-T7 IGF Arabidopsis thaliana genomic clone F20P5, genomic survey sequence.	1139	DNA	Arabidopsis thaliana
	B08201	F20P5-T7.2 IGF Arabidopsis thaliana genomic clone F20P5, genomic survey sequence.	1093	DNA	Arabidopsis thaliana
	B10948	F20P5-T7.1 IGF Arabidopsis thaliana genomic clone F20P5, genomic survey sequence.	1087	DNA	Arabidopsis thaliana
	B11623	F20P5-Sp6 IGF Arabidopsis thaliana genomic clone F20P5, genomic survey sequence.	739	DNA	Arabidopsis thaliana
	B08490	F20P5-Sp6.1 IGF Arabidopsis thaliana genomic clone F20P5, genomic survey sequence.	1204	DNA	Arabidopsis thaliana
	GR985151	TransId-84374 CACAT36FR28 Coffea arabica cDNA clone CACAT36FR28_Q3_08_L19_300.F similar to Symbol: None \| expressed protein, similar to hypothetical protein GI:4455225 from (Arabidopsis thaliana) \| chr1:26423612-26426188 FORWARD \| Aliases: F20P5.12, F20P5_12, mRNA sequence.	298	mRNA	Coffea arabica
	GR987001	TransId-89202 CACAT36L Coffea arabica cDNA clone CACAT36L_32_J13_202.F similar to Symbol: None \| expressed protein, similar to hypothetical protein GI:4455225 from (Arabidopsis thaliana) \| chr1:26423612-26426188 FORWARD \| Aliases: F20P5.12, F20P5_12, mRNA sequence.	516	mRNA	Coffea arabica
	GR982008	TransId-73802 CACAT36FL Coffea arabica cDNA clone CACAT36FL_43_L09_140.F similar to Symbol: None \| expressed protein, similar to hypothetical protein GI:4455225 from (Arabidopsis thaliana) \| chr1:26423612-26426188 FORWARD \| Aliases: F20P5.12, F20P5_12, mRNA sequence.	533	mRNA	Coffea arabica
	GR989002	TransId-95136 CACAT36MER Coffea arabica cDNA clone CACAT36MER_Q2_09_07G01.F similar to Symbol: None \| sterile alpha motif (SAM) domain-containing protein, contains Pfam profile PF00536: SAM domain (Sterile alpha motif) \| chr1:26430121-26433024 FORWARD \| Aliases: F20P5.10, F20P5_10, mRNA sequence.	752	mRNA	Coffea arabica
	DY650163	PU4_plate32_P24 PU4 Prunus persica cDNA similar to expressed mRNA inferred from Contig1368 Prunus persica similar to AT1G70160.1 expressed protein, similar to hypothetical protein GI:4455225 from (Arabidopsis thaliana) chr1:26423612-26426188 FORWARD Aliases: F20P5.12, F20P5_12, mRNA sequence.	572	mRNA	Prunus persica
	FP039813	Quercus robur xylem EST, clone LG0AAB14YE02RM1, similar to O04527_ARATH F20P5.9 protein . - Arabidopsis thaliana.	655	mRNA	Quercus robur
	CA847385	EST0292 CM334 Root cDNA Capsicum annuum cDNA clone R23-40 similar to Arabidopsis thaliana F20P5.10 protein, mRNA sequence.	635	mRNA	Capsicum annuum
	DD182725	JP 2005192478-A/183: A set of PCR primer pairs for mapping for use in Arabidopsis thaliana and a method of mapping a mutant gene using the same.	20	DNA	synthetic construct
	EH370494	G12_j001_plate_22 j001 Nicotiana benthamiana cDNA 5' similar to F20P5.14 protein, mRNA sequence.	395	mRNA	Nicotiana benthamiana
	DD182726	JP 2005192478-A/184: A set of PCR primer pairs for mapping for use in Arabidopsis thaliana and a method of mapping a mutant gene using the same.	20	DNA	synthetic construct
	EH365585	e07_j001_plate_167 j001 Nicotiana benthamiana cDNA 5' similar to F20P5.25 protein, mRNA sequence.	342	mRNA	Nicotiana benthamiana
	AF387007	Arabidopsis thaliana Similar to Synechocystis antiviral protein (F20P5.20) mRNA, partial cds.	2757	mRNA	Arabidopsis thaliana
	AY065147	Arabidopsis thaliana unknown protein (At1g70180; F20P5.10) mRNA, complete cds.	1829	mRNA	Arabidopsis thaliana
	DU169726	24-L026096.SEQ Pigeonpea genomic pBluescript library Cajanus cajan genomic 5', genomic survey sequence.	1146	DNA	Cajanus cajan
	GT007596	TransId-235601 CAET42MIX Coffea arabica cDNA clone CAET42MIX-CFEX874TV similar to F20P5.20 protein - Arabidopsis thaliana (Mouse-ear cress), mRNA sequence.	735	mRNA	Coffea arabica
	GR993501	TransId-199399 CarCatBudEnri Coffea arabica cDNA clone CarCatBudEnri_01-D09 similar to Hypothetical protein At1g70180; F20P5.10 - Arabidopsis thaliana (Mouse-ear cress), mRNA sequence.	881	mRNA	Coffea arabica
	GT004217	TransId-201577 CarCatLeEnri Coffea arabica cDNA clone CarCatLeEnri_01-H03 similar to Hypothetical protein At1g70180; F20P5.10 - Arabidopsis thaliana (Mouse-ear cress), mRNA sequence.	792	mRNA	Coffea arabica
	BU275526	Cr_Emb_02G06_TEXF1 Convoluta roscoffensis embryos from Eva Jiminez Symsagittifera roscoffensis cDNA clone Cr_Emb_02G06 5' similar to O04530 F20P5.12 PROTEIN. Arabidopsis thaliana (Mouse-ear cress), mRNA sequence.	313	mRNA	Symsagittifera roscoffensis
	GT006521	TransId-232730 CAET42MIX Coffea arabica cDNA clone CAET42MIX-CFEWB06TV similar to F20P5.18 protein - Arabidopsis thaliana (Mouse-ear cress), mRNA sequence.	767	mRNA	Coffea arabica
	GT000250	TransId-213009 CACATN1 Coffea arabica cDNA clone CACATN1-4102TV similar to Hypothetical protein At1g70180; F20P5.10 - Arabidopsis thaliana (Mouse-ear cress), mRNA sequence.	828	mRNA	Coffea arabica
	GT002161	TransId-208458 CACATN1 Coffea arabica cDNA clone CACATN1-2J73TV similar to Hypothetical protein At1g70180; F20P5.10 - Arabidopsis thaliana (Mouse-ear cress), mRNA sequence.	903	mRNA	Coffea arabica
	FP045129	Quercus petreae bud EST, clone LG0AAC27YH20RM1, similar to O04527_ARATH F20P5.9 protein . - Arabidopsis thaliana.	591	mRNA	Quercus petraea
	GT007892	TransId-236443 CAET42MIX Coffea arabica cDNA clone CAET42MIX-CFEXI49TV similar to F20P5.20 protein - Arabidopsis thaliana (Mouse-ear cress), mRNA sequence.	791	mRNA	Coffea arabica
	GR995277	TransId-224384 CACATN1 Coffea arabica cDNA clone CACATN1-7N44TV similar to Hypothetical protein At1g70180; F20P5.10 - Arabidopsis thaliana (Mouse-ear cress), mRNA sequence.	607	mRNA	Coffea arabica
Now loading

PAGE TOP